OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 26.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"USGIN content model"×
Drilling and Completion×

Cape EGS: Gold 2-IB Mass Spectrometry and Mudlogs

Apr 30, 2025
6.61 MB
Curated
This dataset contains logs and summaries from the Gold 2-IB well at the Cape EGS site near Utah FORGE, collected during operations in fall 2024. The dataset includes a mass spectrometry log, mudlog, measurement while drilling (MWD) data, and daily geology summaries. The mass spect...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergymass spectrometrymudlogegscape egsgold 2-ibgoldmwddrilling logsutah forgegas analysisraw datalithologywell loggingdepth profileslasrock cuttingsdrilling data

Cape EGS: Gold 4-PB: Mudlog, Mass Spectrometry, Triple Combo, and Dipole Sonic-Derived Geomechanical data

Apr 30, 2025
30.1 MB
Curated
This dataset includes geological and geophysical well logs from the Gold 4-PB well at the Cape EGS site near Utah FORGE, collected between December 2024 and January 2025. The dataset covers lithological, geochemical, and petrophysical data acquired during and after drilling. Data ...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergycape egsutah forgeegsgold-4-pbgoldmass spectrometrymud logtriple combodipole sonicgeomechanicspetrophysicsresistivityporositywell logsanisotropygas analysislasraw data

Project Red: Monitoring Well 73-22 Geophysical and Mud Logging Data 2022

Jul 30, 2025
19.14 MB
Curated
This dataset contains open-hole geophysical and mud logging measurements acquired in 2022 from Monitoring Well 73-22 in the Blue Mountain Geothermal Field, Humboldt County, Nevada. Data were collected by Baker Hughes, Baker Atlas, Horizon Well Logging, and other service providers ...
Authors
Dadi, S. et al Fervo Energy
geothermalenergyblue mountainblue mountain geothermal fieldegsnevadahumboldt county73-22monitoring wellproject redgeothermal well logswell logsgeophysical loggingmud loggingacoustic slownesscompressional slownessshear slownessstoneley wavemonopole acousticdipole acousticazimuthal anistropygamma ray logresistivity logneutron porositydensity logcaliper logborehole conditionsbulk modulusshear modulusmechanical propertieslithologyalteration mineralsfracturesgas detectionlasraw dataprocessed datafervo

Recovery Act: Microhole Tubing Bending Report

Jan 01, 2012
Size unavailable
Curated
A downhole tubing bending study was made and is reported herein. This study developed a model to predict the shape of the pipe at downhole conditions and determines if the various pipe string sizes can reach a specified landing depth. The wellbore trajectory is described by this s...
Authors
Ruan, C. Impact Technologies LLC
geothermaltubingdrill pipedrillingmicroholemicroboretubing bendingwell constructionmodelabrasive slurryjet technologyegs

EGS Collab Experiment 1: Common Discrete Fracture Network

Sep 18, 2019
5.69 MB
Publicly accessible
This package includes data and models that support hydraulic fracture stimulation and fluid circulation experiments in the Sanford Underground Research Facility (SURF). A paper by Schwering et al. (2020) describes the deterministic basis for developing a "common" discrete fracture...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsgeophysicsfracturenetworkdiscrete fracture networkdfnfluidflowmodeldatafluid circulationboreholeweepcoresystemenhanced geothermal systemsandia national laboratorieselectrical resistivitywellinjection testtracerdrilling

Wister, CA Downhole and Seismic Data

Dec 18, 2010
768.6 MB
Publicly accessible
This submission contains Downhole geophysical logs associated with Wister, CA Wells 12-27 and 85-20. The logs include Spontaneous Potential (SP), HILT Caliper (HCAL), Gamma Ray (GR), Array Induction (AIT), and Neutron Porosity (NPOR) data. Also included are a well log, Injection T...
Authors
Akerley, J. Ormat Nevada Inc
geothermalwistercaliforniadrillingwell datapressuretemperaturespinnerptsgeophysicsdownholewell loginjection test12-27boreholelithologymineral compositionmud loggas analysisimperial countyspontaneous potentialspgamma raygrneutron porositynporarray inductionaitimperial valleyresistivity85-20circulation3d seismicseismicgeophysical surveyreflectionp-wavemulti-component3ckirchhoff pre stackrefractionshear waveexplorationrisk reduction

Play Fairway Analysis of the Snake River Plain, Idaho: Final Report

Feb 19, 2021
74.24 MB
Publicly accessible
This submission includes the final project report of the Snake River Plain Play Fairway Analysis project as well as a separate appendix for the final report. The final report outlines the application of Play Fairway Analysis (PFA) to geothermal exploration, specifically within the...
Authors
Shervais, J. et al Utah State University
geothermalenergysrppfasnake river plainidahoblindresourcecharacterizationgeologyblind resourcesblind systemswestern snake river plaincentral snake river plaingeophysicsgravitymagneticsseismictemperaturegeothermometrygeochemistryaqueoustrace elementsisotoperadiometrywellarcgispythoncommon risk segment mappingcrsccrsgeochemicalmagnetotelluricsmtconceptual modelgisthermal modelinghydrothermalintegrated modelintegrated geohydrological modelgeology mapengineered geothermal systemegsmapdrillingwater chemistrypetrographyplay fairway analysisalgorithm

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

SMP and Fracture Modeling

Oct 01, 2021
8.59 MB
Publicly accessible
The problem of loss circulation in geothermal wells is inherently challenging due to high temperatures, brittle rocks, and presence of abundant fractures. Because of the inherent challenges in geothermal environments, there are limitations in selecting proper lost circulation mate...
Authors
Salehi, S. et al University of Oklahoma
geothermalenergylost circulationfracture sealingshape memory polymerdiscrete element methodsmodelingeconomicdrillingtechnologylost circulation materiallcmsmpprocessed datacfdcomputational fluid dynamicsdem

2011 Glass Buttes Exploration and Drilling

Jan 01, 2011
1.27 MB
Publicly accessible
2011 Geothermal Technologies Program Peer Review Presentation summarizing relevance, proposed approach, and logistics of the Glass Buttes Exploration and Drilling.
Authors
Walsh, P. Ormat Nevada Inc
geothermalglass buttesoregongeophysicalgeochemicalhydrothermalalterationremote sensingtimelinebudgetgradienttemperature logsfault geometryaeromagneticlidarhyperspectralgravitymineral assemblages3d geologic modelfield workexplorationdrilling

Hard Rock Drilling Optimization Software

Oct 07, 2021
284.26 MB
Publicly accessible
The main objective of the developed software is to reduce the cost per foot during drilling, in other words, optimize the drilling operational parameters in achieving optimum ROP while avoiding critical operational parameters due to either low ROP, drillstring vibration, accelerat...
Authors
Al Dushaishi, M. and Hareland, G. Oklahoma State University
geothermal drillingdrilling optimizationdrilling simulationhard rock drillinggeothermalsoftwareoptimizationsimulationhard rockdrillingdrilling analysisguicustom softwaremodel

Operational Performance Requirements For Motor Power Sections Used in Geothermal Drilling Based Upon Minimum Specific Energy

Sep 10, 2014
869.71 kB
Publicly accessible
Operational performance requirements are needed to support development of specifications for downhole motor power sections to be used for drilling hard rock during geothermal wellbore construction. Theoretical torque specifications are derived based upon a widely-accepted rock-re...
Authors
Raymond, D. Sandia National Laboratories
geothermalmotordownholespecific energytorquepower sectionbit wearhydrostatic pressureheterogeneous rockheterogeneous geologynon-ideal drilling conditionspoor drilling conditionsoperationsperformance requirementsmotor power sectionsdrillingwellwellboreconstruction

Geothermal Play-Fairway Analysis of Washington State Prospects: Final Report

Sep 30, 2021
Size unavailable
Publicly accessible
This package includes the final technical report for the Play-Fairway project in Washington State. It includes all activities and reporting from phases 1, 2, and 3. The primary goal of this study is to develop a suite of tools and methods that help identify a ?fairway? where the t...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay-fairwaywashingtonpfareportmt surveyspassive-seismic surveyspotential-field surveyspassive seismic surveyspotential field surveyselectrical resistivity surveysgeologic mappinggeochronologypermeabilitymodelmodelsheat potentialgps time serieswellmud loggingcore handling

Devices Suitable for Sectional Isolation Along Both Cased and Open-hole Wellbores Geomechanical Packer Formation Model Iteraction

Jun 20, 2023
73.05 MB
Publicly accessible
The main goal of this project is to develop an annular isolation system capable to withstand geothermal downhole conditions and mitigate the problems experienced by conventional packers in FORGE wells. This presentation outlines the work in rock modelling and interaction with the ...
Authors
Ghassemi, A. et al Welltec
geothermalenergywellborecasingdrillingtechnicalassessmentstimulationforgeegs

Fallon FORGE: Geophysics and Geochemistry

May 23, 2016
257.08 MB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturelidargravitygeochemistryseismicnevadaaeromagcarson sink gravitygeochemistycomplete bougergravity gradientrelative gravitytopographic surveyinggeophysicalgeophysicsseismic profilesmud logwell logchurchill countyacquisition reportbouger anomalyfallon forgewelllog

Lost Circulation Materials in Geothermal Drilling: Single Fracture Clogging Experments

Jan 06, 2025
9.9 MB
In progress
The submitted dataset was generated by a series of laboratory fracture clogging (permeability reduction) experiments using commercially available materials used for lost circulation management during geothermal well drilling. The experiments were conducted using a permeability plu...
Authors
Lawrence Berkeley National Laboratory
geothermalenergydrillinglost circulation managementlost circulation materialsfractureclogginglaboratory experiment

Testing LCM on a Large Scale for Geothermal Drilling Applications Using a Novel Experimental Setup

Apr 22, 2022
15.98 MB
Publicly accessible
Rheology data obtained from flow loop tests, performed using different lost circulation materials (LCM) to study their effect on fluid rheology and wellbore hydraulics. The sealing performance of different LCM was tested using different fracture sizes. Five academic papers / repor...
Authors
Mohamed, A. et al University of Oklahoma
geothermal drillinglost circulationsealing efficiencyrheologyhigh temperatureflow loop3d printingtemperaturecharacterizationdrilling fluid additivesshape memory polymergeothermal wellshpht challengesdrilling fluidwellbore hydraulicshole cleaningfluid stabilitysmart lcmht flow looplost circulation materialannular flowrheological propertiesgeothermalenergyviscosifierfiltration controlhphtgeochemistrywellboredrilling technologyexperimenttechnologyreportsgwmodeldrillingprocessed data

Utah FORGE: Well 16A(78)-32 Simplified Discrete Fracture Network Data

Jun 01, 2021
525.86 MB
Publicly accessible
The FORGE team is making these fracture models available to researchers wanting a set of natural fractures in the FORGE reservoir for use in their own modeling work. They have been used to predict stimulation distances during hydraulic stimulation at the open toe section of well 1...
Authors
Finnila, A. Golder Associates Inc.
geothermalenergyutah forgeforgeutah geothermalreservoirengineeringhydraulicfracturingegsdfndiscrete fracture networkwell 16a78-32utahenhanced geothermal systemengineered geothermal systemfracmanroosevelt hot springsroosevelt hot springs geothermal sitemilfordprocessed datacsvwelldrillingstimulationpressuremodelmodeling

High-Pressure and High-Temperature (HPHT) Lost Circulation Material (LCM) Testing

Nov 30, 2021
7.92 MB
Publicly accessible
High-pressure and high-temperature (HPHT) lost circulation material (LCM) rheology test results, LCM particle size distributions (PSD) analysis, and HPHT LCM fluid loss test results. Three academic papers / reports derived from this research are also presented.
Authors
Salehi, S. and Vivas, C. University of Oklahoma
geothermalenergylost circulation materialshpht filtrationfracture sealingparticle size distributionrheologydrilling fluid additivesgelationthermal degradationhigh pressure high temperaturepsdtemperaturemodeldrillingwellboreexperimenttechnologyprocessed datalcm

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

SMP Preparation, Programming, and Characterization

Oct 01, 2021
1.04 MB
Publicly accessible
The problem of loss circulation in geothermal wells is inherently challenging due to high temperatures, brittle rocks, and presence of abundant fractures. Because of the inherent challenges in geothermal environments, there are limitations in selecting proper lost circulation mate...
Authors
Salehi, S. et al University of Oklahoma
geothermalenergylost circulationfracture sealingshape memory polymerdiscrete element methodsmodelingeconomicdrillingtechnologylost circulation materiallcmsmpprocessed datacfdcomputational fluid dynamicsdem

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Data of High-Temperature Dynamic LCM Testing Setup

May 31, 2021
9.94 MB
Publicly accessible
Data from high temperature dynamic sealing tests for various fracture widths, at various temperatures (degrees F), with 5 wt.% bentonite-based mud containing various material fiber contents, at 100 to 400 psi differential pressure. Data from pressure test and evaluation of the dy...
Authors
Magzoub, M. et al University of Oklahoma
geothermal drillinglost circulationshape memory polymergranitefractureswellbore strengtheningsealabilitygeothermalenergylost circulation materialssealing pressurefiltrationsmart lcmsmpfracture sealingdrilling fluid additivestemperaturemodeldrillingwellboreexperimenttechnologyprocessed data

Snake River Plain FORGE: Well Data for INEL-1

Mar 01, 1979
970.66 MB
Publicly accessible
Well data for the INEL-1 well located in eastern Snake River Plain, Idaho. This data collection includes caliper logs, lithology reports, borehole logs, temperature at depth data, neutron density and gamma data, full color logs, fracture analysis, photos, and rock strength paramet...
Authors
Prestwich, S. and Bowman, J. Idaho National Laboratory
geothermalforgeegssrgcinel-1well dataidahoineelsnake river plaintemperate at depthlithologyanalysislogstempaddendumcaliperlog4-armraw datacore sampledensityfull colorfracturegammaraydatarawperforatingdepthfrequencyplotrockstrengthparametereschartlasphotowell padsonicneutrondesnitycompensatedtemperaturengrinductiontesting reportdoefield reporthole diameter4 armfour armwell logloggingbutte countywildcatcore holemechanical caliper logdensity loglithologicp-wave velocitys-wave velocityseismic velocitypoissonyoungs modulusbulk moduluspoissons ratioshear modulusconfining pressurefracture identificationidaho fallsperforating depth controlgamma frequencygamma radiationgamma raywell schematiccompensated sonicboreholecompensated neutronuncompensatedformation densitywell completionnatural gamma radiationspherically focused inductiongeologywell surveygroundwater monitoringaquifercompliancesrgsrp
12Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service