OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 21 of 21.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"potential"×
Drilling and Completion×

Geothermal Play-Fairway Analysis of Washington State Prospects: Final Report

Sep 30, 2021
Size unavailable
Publicly accessible
This package includes the final technical report for the Play-Fairway project in Washington State. It includes all activities and reporting from phases 1, 2, and 3. The primary goal of this study is to develop a suite of tools and methods that help identify a ?fairway? where the t...
Authors
Steely, A. et al Washington Geological Survey
geothermalenergyplay-fairwaywashingtonpfareportmt surveyspassive-seismic surveyspotential-field surveyspassive seismic surveyspotential field surveyselectrical resistivity surveysgeologic mappinggeochronologypermeabilitymodelmodelsheat potentialgps time serieswellmud loggingcore handling

Wister, CA Downhole and Seismic Data

Dec 18, 2010
768.6 MB
Publicly accessible
This submission contains Downhole geophysical logs associated with Wister, CA Wells 12-27 and 85-20. The logs include Spontaneous Potential (SP), HILT Caliper (HCAL), Gamma Ray (GR), Array Induction (AIT), and Neutron Porosity (NPOR) data. Also included are a well log, Injection T...
Authors
Akerley, J. Ormat Nevada Inc
geothermalwistercaliforniadrillingwell datapressuretemperaturespinnerptsgeophysicsdownholewell loginjection test12-27boreholelithologymineral compositionmud loggas analysisimperial countyspontaneous potentialspgamma raygrneutron porositynporarray inductionaitimperial valleyresistivity85-20circulation3d seismicseismicgeophysical surveyreflectionp-wavemulti-component3ckirchhoff pre stackrefractionshear waveexplorationrisk reduction

Hotspot Project: The Snake River Geothermal Drilling Project Initial Report

Jan 01, 2012
1.71 MB
Publicly accessible
The Snake River volcanic province (SRP) overlies a thermal anomaly that extends deep into the mantle; it represents one of the highest heat flow provinces in North America. The primary goal of this project is to evaluate geothermal potential in three distinct settings: (1) Kimama ...
Authors
Shervais, J. et al Utah State University
geothermalhotspot projectbasaltgeophysicalkimamakimberleygravitymagneticseismicloggingidahoaquifersnake rivervolcanic provinceplainhotspotexplorationrhyolitedrillingdownholelithologylithologic logstratigraphic column

Utah FORGE: Evaluation of Potential Geochemical Responses to Injection in the FORGE Geothermal Reservoir

Apr 03, 2019
324.78 kB
Publicly accessible
Plugging of fracture porosity from mineral precipitation due to injecting cold water into a a geothermal reservoir can impact the overall permeability of the fracture network in the reservoir. This can have serious ramifications on the efficiency of the geothermal resource. Geoche...
Authors
Patil, V. and Simmons, S. Energy and Geoscience Institute at the University of Utah
geothermalenergyforge-utahgeochemistrynumerical modelingfractureinjection testporosityfracture networkmodelingwell 58-32well datastimulationdrillingroosevelt hot springswell 45-3reservoirmineralsthermalaqueousquartzcalciteillitekaolinitephpolythermalreaction pathutah forgeegsmilfordutahenergy geoscience institute

Deep Sedimentary Basin EGS Development Reports

Jan 24, 2013
665.96 MB
Curated
This submission includes a Stage Gate Report on "Novel Geothermal Development of Deep Sedimentary Systems in the United States," along with supporting reports, presentations, and theses related to deep sedimentary basin geothermal development.. Stratigraphic reservoirs with high ...
Authors
Allis, R. and Moore, J. University of Utah
geothermalsedimentary aquifersbasin stratigraphytemperature distributionsheat flowreservoir modelingstratigraphic reservoirspermeabilityhydrofracturingdrillingpower productionsolarcarbonatessiliciclasticsreportdeep sedimentarystage gatetechnical report

Fallon FORGE: Lithology Logs and Well 21-31 Drilling Data

Mar 11, 2018
128.85 MB
Publicly accessible
This submission includes lithology logs for all Fallon FORGE area wells; determined from core, cuttings, and thin section. Wells included are 84-31, 21-31, 82-36, FOH-3D, 62-36, 18-5, 88-24, 86-25, FOH-2, 14-36, 17-16, 34-33, 35A-11, 51A-20, 62-15, 72-7, 86-15, Carson_Strat_1_36-3...
Authors
Blankenship, D. et al Sandia National Laboratories
geothermalenergyfallonforgeegsnevadalithologywellscorecuttingsdepth intervalsgeologyvetted-nodrill logwell loggeologic unitextentnvdrillingloggingmud reportdrilling parametersmud lossesdirectional drillingwireline logsfracturesmineralsmineralogytemperaturegasesgamma raygamma radiationself potentialspontaneous potentialresistivitynphole diametersphi21-31datawelllog

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

Geothermal Exploration Cost and Time

Feb 13, 2013
14.89 kB
Publicly accessible
This paper describes the methodology used to define the baseline exploration suite of techniques (baseline), as well as the approach that was used to create the cost and time data set that populates the baseline. The resulting product, an online tool for measuring impact, and the ...
Authors
Jenne, S. National Renewable Energy Laboratory
geothermalcosttimeexplorationgeophysicsgeochemistrydrillingremote sensingeconomic

Hawaii Play Fairway Analysis: Lanai Daily Drilling Reports

Jul 05, 2019
452.14 kB
Publicly accessible
The Hawaii Play Fairway Project deepened an already existing water well in Palawai Basin, Lanai island. Lanai Well #10 was deepened from 427 m to ~1057 m, with nearly continuous rock core collected. Spanning the dates from May 13 to July 5, 2019, the daily drilling reports of Lana...
Authors
Thomas, D. and Lautze, N. University of Hawaii
geothermalenergylanaigroundwaterhawaiiwaterwellcore photosdrillingdrilling datadrilling logspalawai basindatareport

Chemical, Calcium Phosphate Cements for Geothermal Wells Corrosion Protection, Bond Strength and Matrix Self-Healing

Sep 26, 2017
704 kB
Publicly accessible
The data set shows performance of economical calcium phosphate cement (Fondu) blended with fly ash, class F (FAF) in carbon steel corrosion protection tests (corrosion rate, corrosion current and potential), bond and matrix strength, as well as matrix strength recovery after impos...
Authors
Sugama, T. Brookhaven National Laboratory
geothermalenergycarbon steel corrosioncorrosion rateself-healinghigh temperaturehigh temphigh-tempcasingexperimentwellboreintegritycorrosion protectioncomposite

GEOPHIRES Simulations for Deep Direct Use (DDU) Projects

Jun 30, 2020
186.36 kB
Publicly accessible
This folder contains the GEOPHIRES codes and input files for running the base case scenarios for the six deep direct-use (DDU) projects. The six DDU projects took place during 2017-2020 and were funded by the U.S. Department of Energy Geothermal Technologies Office. They investiga...
Authors
Beckers, K. National Renewable Energy Laboratory
geothermalenergyddugeophiresdeep direct uselcoheconomicsabsorption chillersubsurface storagetechno-economiclevelized cost of heatwellboreexperimentcostsimulationmodelingreservoirtemperaturetechnologyabsorptionportland basinillinois basinwvuwest virginia universitywest virginiaportlandoregonchampagne-urbanaillinoisuniversity of illinoisurbana-champaignchampaign-urbanacornellhawthornenevadaporosityflowthermal conductivityinjection testdrillingwell data

Cornell University Borehole Observatory Sidewall Core Data

Jul 16, 2026
385.18 MB
In progress
This data set includes sidewall core data from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 and total dep...
Authors
Tester, J. et al Cornell University
geothermalenergycornell universitycubodeep direct usedistrict heatingddudeep wellwell datadrillingesh-1api 31109300030000appalachian basin

Cornell University Borehole Observatory Pason Drilling Parameters

Jun 24, 2026
137.28 MB
In progress
This data set included drill rig drilling parameters from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 an...
Authors
Fulton, P. et al Cornell University
geothermalenergyegsdirect useappalachian basindrilling datacornell universitycubodeep direct useddudistrict heatingdeep welldrillingesh-1api 31109300030000

Sedimentary Geothermal Feasibility in Nevada, Western Utah, Colorado, and the Gulf Coast Region of Texas Final Report

Jul 01, 2020
Size unavailable
Publicly accessible
The objectives of this project were to (1) perform a literature review of sedimentary geothermal resources, (2) identify data sources and develop data-collection methodologies that characterize selected resources, (3) screen sedimentary basins and formations for sedimentary geothe...
Authors
Johnston, H. et al National Renewable Energy Laboratory
geothermalenergysedimentaryfeasibilitysedimentary basinelko basinrailroad valleysteptoe valleypavant buttedenver basinpiceance basinraton basingulf coast regionnevadautahtexasgbcaasgreat basin carbonate and alluvial aquifer systemcarbonateagsadvanced geothermal systembottom-hole temperaturewell datalcoeeconomicsupperlowercarbonate aquifer unitegsenhanced geothermal systemplay fairway analysiscoloradotemperaturebottom-holemarys river basindrillingpermeabilityreservoirmodelingcarbonate geothermal systemcgstechno-economicanalysisdownselectsubsurfacedata mininggeologygradientheatflowgeophysicsseismicclosed-loophydrogeologycoststructuralbedrockmapaquifersedgeo

Project HOTSPOT: Kimberly Well Core Photos

Jun 16, 2011
944.97 MB
Curated
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalkimberlyproject hotspotyellowstone hotspotborehole geophysicsidahosnake river plainphotossrpcontinuous volcanismdownhole geophysicsphoto core logcore sampledrillingcorewell data

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

Project HOTSPOT: Mountain Home Well Core and Drill Site Photos

Jan 11, 2012
937.4 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalsnake river plainidahoyellowstone hotspotproject hotspotborehole geophysicsmountain homedrillingphoto core logdownhole geophysicsphotossrpcontinuous volcanismcore samplecore logwell datacore

Project Red: Monitoring Well 73-22 Geophysical and Mud Logging Data 2022

Jul 30, 2025
19.14 MB
Curated
This dataset contains open-hole geophysical and mud logging measurements acquired in 2022 from Monitoring Well 73-22 in the Blue Mountain Geothermal Field, Humboldt County, Nevada. Data were collected by Baker Hughes, Baker Atlas, Horizon Well Logging, and other service providers ...
Authors
Dadi, S. et al Fervo Energy
geothermalenergyblue mountainblue mountain geothermal fieldegsnevadahumboldt county73-22monitoring wellproject redgeothermal well logswell logsgeophysical loggingmud loggingacoustic slownesscompressional slownessshear slownessstoneley wavemonopole acousticdipole acousticazimuthal anistropygamma ray logresistivity logneutron porositydensity logcaliper logborehole conditionsbulk modulusshear modulusmechanical propertieslithologyalteration mineralsfracturesgas detectionlasraw dataprocessed datafervo

Play Fairway Analysis Retrospective GeoRePORTs

Dec 01, 2020
28.78 MB
Publicly accessible
NREL, as part of the Play Fairway Analysis (PFA) Retrospective and with assistance from PFA PIs, completed GeoRePORTs for the sites identified in Phases 1&2 of the DOE PFA projects. The GeoRePORT (geothermal resource portfolio optimization and reporting technique) uses two factor...
Authors
Kolker, A. et al National Renewable Energy Laboratory
geothermalenergypfageoreportsrpsnake river plainidahoblindresourcecharacterizationwashingtonmshszmsh-nwrvwind river valleymount st. helensshear zonenorthwashington stateplay fairway analysishawaiilanaimauna keaegbeastern great basintwin peaksutahcove fortcrater knollmountain homenevadanevada great basingranite springs valleynorthernsou hillscrescent valleysouthern gabbs valleytularosa basinnew mexicoadf-sw/nasaadfaerospace data facilityfort blissmcgregor rangewsmrwhite sands missile rangemount bakercamas prairiepermeabilitydrillinglogisticsmarkettransmissionland access

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Curated
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

Project HOTSPOT: Kimama Well Core and Drill Site Photos

Jan 16, 2011
106.28 MB
Publicly accessible
The Snake River Plain (SRP), Idaho, hosts potential geothermal resources due to elevated groundwater temperatures associated with the thermal anomaly Yellowstone-Snake River hotspot. Project HOTSPOT has coordinated international institutions and organizations to understand subsurf...
Authors
Shervais, J. Utah State University
geothermalproject hotspotyellowstone hotspotborehole geophysicsidahosnake river plainkimamaphotossrpcontinuous volcanismdownhole geophysicsphoto core logcore sampledrillingcorewell data
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service