OpenEI: Energy Information
  • Geothermal Data Repository
  • My User
    • Sign Up
    • Login
 
  • Data
    • View All Submissions
    • Data Lakes
    • Data Standards
    • Submit Data
  • Help
    • Frequently Asked Questions
    • Data Submission Best Practices
    • Data Submission Tutorial Videos
    • Contact GDR Help
  • About
  • Search

Search GDR Data

Showing results 1 - 25 of 105.
Show results per page.
Order by:
Available Now:
Filters Clear All Filters ×
Topic
Technologies
Demonstration Sites
Data Type
"point data"×
Drilling and Completion×

U.S. Army Garrison West Point, West Point, New York State

Jul 20, 2025
Size unavailable
In progress
This collection includes datasets used for the analyses and modeling of low-temperature geothermal resources at the U.S. Army Garrison West Point in West Point, New York State. This project file includes tabular and geospatial data accessed from publicly available repositories hel...
Authors
University of Illinois Urbana-Champaign
geothermalenergywest point academynew york stategeologichydrogeologicgeophysicsdrilling

Recovery Act: Microhole Tubing Bending Report

Jan 01, 2012
Size unavailable
Publicly accessible
A downhole tubing bending study was made and is reported herein. This study developed a model to predict the shape of the pipe at downhole conditions and determines if the various pipe string sizes can reach a specified landing depth. The wellbore trajectory is described by this s...
Authors
Ruan, C. Impact Technologies LLC
geothermaltubingdrill pipedrillingmicroholemicroboretubing bendingwell constructionmodelabrasive slurryjet technologyegs

Hawthorne Nevada Deep Direct-Use Feasibility Study References, Reports, Literature

Mar 29, 2018
189.25 MB
Publicly accessible
The objective of this project is to use a multi-disciplinary, three-tiered approach to assess the geothermal resource and determine the feasibility of implementing a large-scale, direct-use facility for the Hawthorne Army Depot (HAD) and the various town and county facilities in H...
Authors
Lowry, T. Nevada Bureau of Mines and Geology
geothermalenergynevadadirect usedeep direct usewellsgeochemistrygeophysicsreservoir modelingquaternary faultshawthorne army weapons depotdduhawthorneel capitandrillingwell datadrilling data

Fallon FORGE: Well Data, Geophysical Data, and Geologic Maps

Mar 31, 2016
1.87 GB
Publicly accessible
The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS a...
Authors
Blankenship, D. Sandia National Laboratories
geothermalegsfallonforgecarson sinkbasin and rangetemperaturewellnevadamudloggeologic mapnv17-16drilling13-3635a-11boundarylease86-1534-3378-36demneadastewart and carlson 1978hinz et. al. 2011bell et. al. 2010bell and house 2010maurer and welch 2001ndothighwaysgravitymtseismicityflow testfoh-3earthquakes61-36pressuresurveyboreholedrogamma rayacoustilogx-multipole array47a-11well drilling51a-2056a-1458a-914-162-1584-3182-3686-2586a-15semblancegammaheat flowfoh 3seismicnavy gporadiogenic heat measurementstemperature gradientmagnetotelluric88-24mud loggeophysicsgeologymapgeologicexplorationsitecharacterizationsubsurfacewell dataradiogenicheatgeospatial datadata

High-Pressure and High-Temperature (HPHT) Lost Circulation Material (LCM) Testing

Nov 30, 2021
7.92 MB
Publicly accessible
High-pressure and high-temperature (HPHT) lost circulation material (LCM) rheology test results, LCM particle size distributions (PSD) analysis, and HPHT LCM fluid loss test results. Three academic papers / reports derived from this research are also presented.
Authors
Salehi, S. and Vivas, C. University of Oklahoma
geothermalenergylost circulation materialshpht filtrationfracture sealingparticle size distributionrheologydrilling fluid additivesgelationthermal degradationhigh pressure high temperaturepsdtemperaturemodeldrillingwellboreexperimenttechnologyprocessed datalcm

Practices Maintain Straight Hole in Crooked Hole Conditions, While Also Enabling Significant Gains in Drill Rate

Apr 30, 2014
Size unavailable
Publicly accessible
Bottom hole assembly (BHA) designs were assessed in field trials for their ability to achieve critical low inclination requirements, while simultaneously enabling high drill rates. Because angle has historically been controlled by reducing weight on bit (WOB), these are often com...
Authors
Knudsen, S. et al Sandia National Laboratories
geothermalbhadrillingpacked bhapendulum bhamsemcginness hills fieldwobbottom hole assemblyweight on bitmechanical specific energyspeinclinationanglemcginness hills

EGS Collab Experiment 1: 4850L Downhole Camera Surveys During Injection

May 25, 2018
784.41 MB
Publicly accessible
This package includes data and footage from two rounds of downhole camera surveys performed at the Sanford Underground Research Facility (SURF) on the 4850 level. The exercise was performed once on 25 May 2018 and once on 21 December 2018. On May 25th, the first round was done dur...
Authors
Schwering, P. et al Sandia National Laboratories
geothermalenergyegs collabsurfhydraulicfracturingstimulationsanford underground research facilityexperimentegsdownhole cameraboreholestressdatapressureproduction wellflowinjectionjetsjetting pointfracturewellboreinjection ratefoliationdepthwell datainjection teste1-pdrillinggeovisiondual-scan micro video camera

WISE-CASING: Frequency Domain EM Data from Cymric Oil Field, CA

Apr 30, 2019
1.02 MB
Publicly accessible
Cymric oil field frequency domain electromagnetic (FEM) data with two parts of data labeled Part 1 and Part 2. Part 1 utilizes an electrical source line parallel to the receiver line, while Part 2 utilizes an electrical source line at a 75 deg angle to the receiver line. Data are ...
Authors
Wang, J. et al Lawrence Berkeley National Laboratory
geothermalenergyemgeophysicsfemfield testfield dataexperiment5hz1hzcross-sectionalem datacymric fieldelectromagneticcaliforniakern countywellborewellcasingintegritygeophysicalfdemwise-casinglow frequencypotential fieldelectric fieldmodelforwardmodelingmodellingsimulationfielddataelectrostaticresponsenumericalsimulatedfrequency domaincorrosionborehole2-8cymricoilsteam floodsensingassessment

WISE-CASING: Seismic Experiment at Richmond Field Station, CA

Apr 25, 2018
27.61 MB
Publicly accessible
This experiment is testing the tube waves reflected from the bottom of the well. We put six single-channel geophones on the surface and a 24-channel downhole hydrophone into the well. The well is about 30 meters deep. Just a steel casing in the sand formation, no cement.
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismicgeophonehydrophonegeophysicssgysegydatavelocityexperimentrichmond field stationdownhole hydrophonewellmonitoringseismicitydasdistributed acoustic sensingwise-casingwellborecasingintegrityassessmentsensingdownholesteel casing

Utah FORGE: Well 16A(78)-32 Drilling Data

Jan 08, 2021
2.57 GB
Publicly accessible
This dataset includes survey data, drilling data, daily reports, summaries of daily operations, and rig photos from the drilling of Utah FORGE well 16A(78)-32, which is a highly deviated deep well. It was completed 60 days ahead of schedule. Rig move in began 10/22/2020 and dril...
Authors
McLennan, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgedrillingdirectional16a78-32time seriessurveytrajectoryraw dataegsrigphotosoperationsdeviateddeep wellhighly deviatedforgeutahpasonpason data

Utah FORGE: Drilling Data for Student Competition

Dec 07, 2018
604.64 MB
Publicly accessible
Diagnostic drilling data (Pason log files) from Well 58-32 (previously labeled MU-ESW1), which was drilled near Milford Utah during Phase 2B of the FORGE Project to confirm geothermal reservoir characteristics met requirements for the final FORGE site. This dataset includes both ...
Authors
Podgorney, R. et al Idaho National Laboratory
geothermalenergyforgeutahstudent competitiondrillingpason58-32egsroosevelt hot springsmilfordlogssubsurfaceperformancerigbitsmaterialsdownscaledmu-esw1roppump pressurewobweight on bitrate of penetrationtemperaturedepthtdtorqueflowwelllogdatadrillphase 2bresourcecharacterizationdrilling datawell datautah forgeraw dataprocessed data

WISE-CASING: Surface Seismic Survey at Cymric Field, California Central Valley

Apr 02, 2018
31.04 MB
Publicly accessible
This test was conducted at the Chevron Cymric oilfield in the California central valley near Bakersfield. A reflected seismic signal was observed in all three components (x, y, z) of the 3-component Episensor geophone, as well as all phones on the single component array. The arriv...
Authors
Wu, Y. et al Lawrence Berkeley National Laboratory
geothermalenergyseismic datacymric oilfieldseismic signal3-component geophonescymric surfacebertical geophonesreflected waveegswellborecasingwise-casingintegritysensingassessmentgeophysicsseismicsurfacecymric

Utah FORGE: Well 78B-32 Daily Drilling Reports and Logs

Aug 09, 2021
11.89 GB
Publicly accessible
This data set includes the daily drilling reports and Pason data for well 78B-32 and Schlumberger logs acquired after drilling completion. This well was drilled between June 27th and July 31st of 2021. Also included is raw and processed data for a variety of well data metrics incl...
Authors
McLennan, J. Energy and Geoscience Institute at the University of Utah
geothermalenergyutah forgewell 78b-32well 78b-32 fmi logswell 78b-32 ubi logswell 78b-32 drilling datautah forge well 78b-32daily reportsdaily drilling reportsprocess dataraw datagamma rayporositylogscementtemperaturedensityresistivityfractureubifmisonicwell databoreholewelldatagammadrillingreportscblcement bond logpason data

WISE-CASING: Time Domain Reflectometry Data from Lab Experiment on Coaxial Cable

Mar 15, 2018
5.05 MB
Publicly accessible
The coaxial-cable experiment conducted in the lab was with 80 m coaxial cable( RG-85). This experiment compares the TDR response between damaged and undamaged cable. For the damaged cable, the damaged section is in the middle (40 m). The amplitude of the data is mV with time (us).
Authors
Wu, Y. and Wang, J. Lawrence Berkeley National Laboratory
geothermalenergytdrexperimentlab testtime domain reflectometrycoaxial-cabledamaged coaxial-cablewellboreintegritycasingcabledamagedwise-casingcoaxialsensingassessment

WISE-CASING: DC Simulation at Containment and Monitoring Institute (CaMI), Calgary, Canada

Apr 30, 2019
570.83 kB
Publicly accessible
For the model calculation we applied EM3D using completion diagram of CaMI site and a background resistivity consistent with the borehole logs. It was also important to use the accurate position of the return electrode. We note that for the data fit the code also incorporated we...
Authors
Wang, J. and Wilt, M. Lawrence Berkeley National Laboratory
geothermalenergyemem3dcamiborehole logsdc modelsandiasimulationfield dataelectrostatic rsponseelectric fieldshierarchical modelinglow frequency em methodvalidationwise-casingcontainment and monitoring institutecmcnumericalfemfielddatafdemsimulatedmodelingmodellingcanadalow frequencyfrequency domaingeophysicsboreholecorrosionintegritywellborewellpotential fieldexcitation5 hzelectromagneticcasingelectric fieldforwardexperiment

Project Data for Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers

Mar 31, 2026
601.08 MB
Awaiting release
This dataset contains project data generated by the project "Evaluation Of Physics-Based Drilling and Alternative Bit Design At The Geysers." It includes drilling, downhole drilling dynamics, bit records, daily drilling reports, directional surveys, lithology and mineralogy data, ...
Authors
Wriedt, J. and So, P. Geysers Power Company, LLC
geothermalenergydrillingthe geysersphysics-based drillingbit designgdc-36prati-44downhole drilling dynamicsbit recordsdirectional surveylithologymineralogymud logspason edrwell logssonic logsfmiubiwell schematicraw data

Newberry EGS Demonstration: Well 55-29 Stimulation Data 2014

Sep 03, 2015
308.58 MB
Publicly accessible
The Newberry Volcano EGS Demonstration in central Oregon, a 5 year project begun in 2010, tests recent technological advances designed to reduce the cost of power generated by EGS in a hot, dry well (NWG 55-29) drilled in 2008. First, the stimulation pumps used were designed to ru...
Authors
Cladhouhos, T. et al AltaRock Energy Inc
geothermalegsdiverter materialmicroseismic monitoringtemperature monitoringgroundwater monitoringstimulation datanewberrywell datainjectivitypts datadaily reportoperations summarytemperature at depthwell head pressuredtstemperaturedepthprofileflow testwhtwhpflow rateflow datapressure databackflow reportgeochemistrygroundwatergas chemistryfield temperatureplhsnewwpad-16pad-29nn-17nn-18ground watersurface waterelhspcgvcpad 16pad 29publicationsgrcstimulationresultspaperdemonstrationproduction wellaltarocksgwstanfordpresentationvolcano2014newberry volcanoenhanced geothermal systemtoughreactthermalhydrologicalmechanicalchemicalpressure fall-offdownhole pressure55-29ptspresssurespinnersurveychartgraphreportdatamonitoring dataseismic dataseismicinduced seismisityanalysisfinal reportfoulger consultinginjectioninduced seismicitymitigationplanaddendumeventlocationsistirawclusteredoutputpnsnwell constructionwellboreschematiccasinghole depthsultrasonicflowratemanual readingsweir boxmeqmicroseismicity

Utah FORGE: Well 56-32 Drilling Data and Logs

Mar 19, 2021
9.48 GB
Publicly accessible
This dataset consists of drilling data (Pason data spreadsheets, daily reports, days v. depth, mud logs), Schlumberger logs (FMI, shear anisotropy analysis, memory, sonic, array induction/spectral density/dual spaced neutron/gamma ray/caliper, spectral GR/temperature, and Gardner ...
Authors
Bristol, J. et al Energy and Geoscience Institute at the University of Utah
geothermalenergywell 56-32 datawell 56-32utah forgewell 56-32 logsutah forge well 56-32well 56-32 schlumberger logswell 56-32 daily drilling reportswell 56-32 pason dataforgeegsschlumbergerpasonlogsloggingwell datafmishear anisotropymemorysonicarray inductionspectral densitydual spacedneutrongammacalipergrspectralgardner densitydensitywell logmud logdaily drilling reportdrill bit bhaday vs depthdrillingeowrend of well reporttemperature

Cape EGS: Gold 6-IB: Mud Log, Mass Spectrometry, and Dipole Sonic-Derived Geomechanical Data

Apr 30, 2025
20.64 MB
Awaiting release
This dataset includes geological and geophysical well log data from the Gold 6-IB well at the Cape EGS site in Utah, collected between January and April 2025. The data span the full well depth from surface to total depth (15,054 feet) and encompass mud log information, mass spectr...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergycape egsgold 6-ibmud logmass spectrometrydipole sonicgeomechanicsutah forgeacoustic slownessporosityanisotropywell logsgas analysislaslithologyraw data

Cornell University Borehole Observatory Pason Drilling Parameters

Jun 24, 2026
137.28 MB
In progress
This data set included drill rig drilling parameters from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 an...
Authors
Fulton, P. et al Cornell University
geothermalenergyegsdirect useappalachian basindrilling datacornell universitycubodeep direct useddudistrict heatingdeep welldrillingesh-1api 31109300030000

Cornell University Borehole Observatory Wireline Sonic Logs

Jul 21, 2026
6.32 MB
In progress
This data set includes wireline geophysical data from well Cornell ESH #1 (API 31109300030000), known as the Cornell University Borehole Observatory, or CUBO. It is a stratigraphic well drilled to characterize potential EGS resources. The Drilling commenced on June 21, 2022 and to...
Authors
Tester, J. et al Cornell University
geothermalenergycornell universitycuboddudeep direct usedistrict heatingdeep wellwell datadrillingesh-1api 31109300030000raw dataappalachian basin

Cape EGS: Gold 4-PB: Mudlog, Mass Spectrometry, Triple Combo, and Dipole Sonic-Derived Geomechanical data

Apr 30, 2025
30.1 MB
Awaiting release
This dataset includes geological and geophysical well logs from the Gold 4-PB well at the Cape EGS site near Utah FORGE, collected between December 2024 and January 2025. The dataset covers lithological, geochemical, and petrophysical data acquired during and after drilling. Data ...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergycape egsutah forgeegsgold-4-pbgoldmass spectrometrymud logtriple combodipole sonicgeomechanicspetrophysicsresistivityporositywell logsanisotropygas analysislasraw data

Cape EGS: Gold 2-IB Mass Spectrometry and Mudlogs

Apr 30, 2025
6.61 MB
Awaiting release
This dataset contains logs and summaries from the Gold 2-IB well at the Cape EGS site near Utah FORGE, collected during operations in fall 2024. The dataset includes a mass spectrometry log, mudlog, measurement while drilling (MWD) data, and daily geology summaries. The mass spect...
Authors
Dadi, S. and Adams, T. Fervo Energy
geothermalenergymass spectrometrymudlogegscape egsgold 2-ibgoldmwddrilling logsutah forgegas analysisraw datalithologywell loggingdepth profileslasrock cuttingsdrilling data

Project Red: Well 34A-22 Casing Integrity, Trajectory, Cement Bond, and Mudlog Data 2022

Jul 30, 2025
11.23 MB
Awaiting release
This dataset contains borehole logging data acquired in March-July 2022 from Fervo Energy geothermal wells in the Blue Mountain Geothermal Field, Humboldt County, Nevada. The submission includes casing inspection and cement evaluation logs, directional and trajectory measurements,...
Authors
Dadi, S. et al Fervo Energy
geothermalenergygeothermal wellswell loggingborehole loggingblue mountain geothermal fieldhumboldt countynevadafervoschlumbergerhalliburtonhorizonbm 34a24-23-22bm 34a31-23-22blue mountain 34alascasing inspectioncement bondacoustic cement evaluationtrajectory logsdirectional logsmudloglogsraw dataprocessed data

INGENIOUS Thermal Conductivity Measurement Source Categorization

Jun 01, 2021
907.64 kB
Publicly accessible
Thermal conductivity (TC) data taken for different wells at a specified drill depth. This is an abridged version of the complete SMU heat flow database, downloaded from the SMU node of the NGDS at the beginning of INGENIOUS (approximately April 2021), and filtered to the INGENIOUS...
Authors
Batir, J. and Gentry, E. University of Nevada, Reno
geothermalenergythermal conductivityingeniouswelldrillingthermalconductivitytestmeasurmentdataraw datasmunevadadatabasenotestcngdsheat flowheatporosity
12345Next >>
Google Map
  • About the GDR
  • Partners & Sponsors
  • Disclaimers
  • Developer Services
  • The GDR provides free access to data generated from projects funded by the U.S. Department of Energy's Office of Geothermal.
  • Content is available under Creative Commons Attribution 4.0 unless otherwise noted.

Privacy Policy Notification

This site uses cookies to store and share user preferences with other OpenEI sites, and uses Google Analytics to collect anonymous user information such as which pages are visited, for how often, and what searches or other webpages may have led users here. You can prevent Google Analytics from recognizing you on return visits to this site by disabling cookies on your browser or by installing a Google Analytics Opt-out Browser Add-on. By clicking "Accept" you agree this site can store cookies on your device and disclose information to OpenEI and Google Analytics in accordance with our privacy policy.

OpenEI Privacy Policy Google Analytics Terms of Service